Cart summary

You have no items in your shopping cart.

    NDUFAF3 Antibody - N-terminal : FITC

    NDUFAF3 Antibody - N-terminal : FITC

    Catalog Number: orb2082258

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2082258
    CategoryAntibodies
    DescriptionNDUFAF3 Antibody - N-terminal : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen for Anti-NDUFAF3 antibody is: synthetic peptide directed towards the N-terminal of Human NDUF3
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW20 kDa
    UniProt IDQ9BU61
    Protein SequenceSynthetic peptide located within the following region: LPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGN
    NCBINP_951032.1
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative names2P1, E3-3, C3orf60, MC1DN18
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars