Cart summary

You have no items in your shopping cart.

NBPF11 Rabbit Polyclonal Antibody

Catalog Number: orb587561

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb587561
CategoryAntibodies
DescriptionRabbit polyclonal antibody to NBPF11
TargetNBPF11
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human NBPF11
Protein SequenceSynthetic peptide located within the following region: FLAKQQNKYKYEECKDLIKSMLRNERQFKEEKLAEQLKQAEELRQYKVLV
UniProt IDQ86T75
MW65kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesNBPF24
NoteFor research use only
NBPF11 Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.