Cart summary

You have no items in your shopping cart.

NBPF11 Rabbit Polyclonal Antibody (FITC)

NBPF11 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2085795

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085795
CategoryAntibodies
DescriptionNBPF11 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human NBPF11
Protein SequenceSynthetic peptide located within the following region: FLAKQQNKYKYEECKDLIKSMLRNERQFKEEKLAEQLKQAEELRQYKVLV
UniProt IDQ86T75
MW65kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNBPF24
NoteFor research use only