You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583692 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NASP |
Target | NASP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NASP |
Protein Sequence | Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV |
UniProt ID | Q5T626 |
MW | 49kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HMDRA1, FLB7527, PRO1999 |
Note | For research use only |
NCBI | NP_689511 |
Anti-NASP antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. NASP Antibody orb583692 concentration 5 ug/ml.
WB Suggested Anti-NASP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. NASP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Mouse, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |