You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325606 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Capn15 |
| Target | MYOCD |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Protein Sequence | Synthetic peptide located within the following region: KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL |
| UniProt ID | Q8VIM5 |
| MW | 106kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti BSAC2A antibody, anti Srfcp antibody, anti My Read more... |
| Research Area | Epigenetics & Chromatin, Protein Biochemistry, Ste Read more... |
| Note | For research use only |
| NCBI | NP_660118 |
| Expiration Date | 12 months from date of receipt. |

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-Myocd Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Pancreas.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
RBITC |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review