MYL6 Rabbit Polyclonal Antibody

• Catalog Number: orb583680
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYL6
• Target: MYL6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYL6
• Protein Sequence: Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
• UniProt ID: P60660
• MW: 17 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LC17, ESMLC, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM,
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_524147
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein may be acetylated and/or phosphorylated.

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Human Prostate

Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MYL6 antibody (orb583680).

WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. MYL6 is supported by BioGPS gene expression data to be expressed in HepG2.