You have no items in your shopping cart.
MYL6 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6 |
| Target | MYL6 |
| Protein Sequence | Synthetic peptide located within the following region: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV |
| Molecular Weight | 17kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MYL6 Rabbit Polyclonal Antibody [orb583680]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μlPhospho-MYL6 (Tyr29+Ser30) Rabbit Polyclonal Antibody [orb6434]
IF, IHC-Fr, IHC-P
Gallus, Human, Porcine, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlMYL6 Rabbit Polyclonal Antibody [orb214289]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-MYL6 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.

Anti-MYL6 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MYL6 Antibody orb583679 concentration 5 ug/ml.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-MYL6 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. MYL6 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
MYL6 Rabbit Polyclonal Antibody (orb583679)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








