MYDGF Rabbit Polyclonal Antibody

• Catalog Number: orb585825
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYDGF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 19kDa
• Target: MYDGF
• UniProt ID: Q969H8
• Protein Sequence: Synthetic peptide located within the following region: YASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAE
• NCBI: NP_061980
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Antibody dilution: 1.0 ug/ml, Sample Type: Human Placenta.

Rabbit Anti-C19orf10 Antibody, Catalog Number: orb585825, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate tissue distribution, resemble Golgi structures, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 â€" 2.0 sec, Protocol located in Reviews and Data.