MYDGF Rabbit Polyclonal Antibody

• Catalog Number: orb585826
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYDGF
• Target: MYDGF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: LLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYA
• UniProt ID: Q969H8
• MW: 19kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROI
• Note: For research use only
• NCBI: NP_061980

WB Suggested Anti-C19orf10 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.