You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583123 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYD88 |
Target | MYD88 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MYD88 |
Protein Sequence | Synthetic peptide located within the following region: TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR |
UniProt ID | Q99836 |
MW | 33kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | IMD68, MYD88D |
Note | For research use only |
NCBI | NP_002459 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 21 kDa isoform.
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-MYD88 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
FC, IF, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |