MUC1 Rabbit Polyclonal Antibody

• Catalog Number: orb578093
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MUC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Goat, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MUC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: MUC1
• UniProt ID: P15941
• Protein Sequence: Synthetic peptide located within the following region: SATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQEL
• NCBI: NP_002447
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that MUC1 is expressed in 721_B.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Human kidney