You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578068 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MUC1 |
Target | MUC1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Porcine |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1 |
Protein Sequence | Synthetic peptide located within the following region: GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL |
UniProt ID | Q7Z552 |
MW | 22kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, Read more... |
Note | For research use only |
NCBI | NP_001037855 |
Sample Type: HepG2 Whole cell lysates, Antibody Dilution: 1.0 ug/ml.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
NMuFG cells in ImmunohistochemistryDilutions 1:50 for the three primary antibodies and 1:100 for FITC-conjugated secondary.
Rabbit Anti-MUC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: Human stomach, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:5000 + 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
ICC, IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Goat, Mouse, Rabbit, Rat | |
Human, Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human, Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |