MUC1 Rabbit Polyclonal Antibody

• Catalog Number: orb578067
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MUC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Goat, Mouse, Rabbit, Rat
• Reactivity: Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MUC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 122 kDa
• Target: MUC1
• UniProt ID: Q7Z550
• Protein Sequence: Synthetic peptide located within the following region: ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM
• NCBI: NP_001037857
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human stomach, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.

Sample Type: Pig stomach, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.

WB Suggested Anti-MUC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. MUC1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.