MTRR Rabbit Polyclonal Antibody

• Catalog Number: orb327247
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MTRR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MTRR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: MTRR
• UniProt ID: Q9UBK8
• Protein Sequence: Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MTRR antibody, anti antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-MTRR Antibody, Catalog Number: orb327247, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-MTRR antibody Titration: 1 ug/mL, Sample Type: Human liver.