You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human MTRR |
| Target | MTRR |
| Protein Sequence | Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA |
| Molecular Weight | 76kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MTRR Rabbit Polyclonal Antibody [orb326228]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlMTRR Rabbit Polyclonal Antibody [orb667359]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-MTRR Antibody, Catalog Number: orb327247, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-MTRR antibody Titration: 1 ug/mL, Sample Type: Human liver.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
MTRR Rabbit Polyclonal Antibody (orb327247)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




