You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326228 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MTRR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 80kDa |
Target | MTRR |
UniProt ID | Q9UBK8 |
Protein Sequence | Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
NCBI | NP_076915 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC129643 antibody, anti MSR antibody, anti c Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Hela cell lysate tissue using MTRR antibody
Western blot analysis of human HeLa tissue using MTRR antibody
Western blot analysis of HepG2 cell lysate tissue using MTRR antibody
Filter by Rating