You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
MTRR Rabbit Polyclonal Antibody
Catalog Number: orb326228
| Catalog Number | orb326228 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MTRR |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 80kDa |
| Target | MTRR |
| UniProt ID | Q9UBK8 |
| Protein Sequence | Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
| NCBI | NP_076915 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti MGC129643 antibody, anti MSR antibody, anti c Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. MTRR is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Rabbit Anti-MTRR Antibody, Catalog Number: orb326228, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-MTRR Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
WB Suggested Anti-MTRR Antibody Titration: 1 ug/mL, Positive Control: Hela cell lysate.
- Item 1 of 3
- Item 1 of 1
