MPDZ Rabbit Polyclonal Antibody

SKU: orb325042

Description

Rabbit polyclonal antibody to MPDZ

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPDZ
• Target: MPDZ
• Protein Sequence: Synthetic peptide located within the following region: DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
• Molecular Weight: 218kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp781P216 antibody, anti FLJ25909 antibody, anti FLJ34626 antibody, anti FLJ90240 antibody, anti MUPP1 antibody

Anti-MPDZ antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MPDZ Antibody orb325042 concentration 5 ug/mL.

Lanes: Lane 1: 30 ug of HeLa cell lysate, Lane 2: 30 ug of 293T cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: MPDZ.

WB Suggested Anti-MPDZ Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

MPDZ

UniProt

O75970

RefSeq (Protein):NP_003820