MPDZ Rabbit Polyclonal Antibody

• Catalog Number: orb325042
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MPDZ
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPDZ
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 218kDa
• Target: MPDZ
• UniProt ID: O75970
• Protein Sequence: Synthetic peptide located within the following region: DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
• NCBI: NP_003820
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp781P216 antibody, anti FLJ25909 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-MPDZ antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. MPDZ Antibody orb325042 concentration 5 ug/mL.

Lanes: Lane 1: 30 ug of HeLa cell lysate, Lane 2: 30 ug of 293T cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: MPDZ.

WB Suggested Anti-MPDZ Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.