LNX1 Rabbit Polyclonal Antibody

• Catalog Number: orb330296
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LNX1
• Target: LNX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LNX1
• Protein Sequence: Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
• UniProt ID: Q8TBB1
• MW: 70kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti LNX antibody, anti MPDZ antibody, anti PDZRN2
• Research Area: Cell Biology, Molecular Biology, Protein Biochemis
• Note: For research use only
• NCBI: NP_116011

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-LNX1 Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.