You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330296 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LNX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LNX1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70kDa |
Target | LNX1 |
UniProt ID | Q8TBB1 |
Protein Sequence | Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA |
NCBI | NP_116011 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LNX antibody, anti MPDZ antibody, anti PDZRN2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-LNX1 Antibody Titration: 1.25 ug/mL, Positive Control: Transfected 293T.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |