You have no items in your shopping cart.
Mouse Thrombospondin 2 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 28.1 kDa |
| Expression Region | 19-232aa |
| Protein Length | Partial |
| Protein Sequence | GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse Thrombospondin 2 protein [orb246015]
Greater than 90% as determined by SDS-PAGE.
26.1 kDa
Yeast
1 mg, 20 μg, 100 μgADAMTS4 Rabbit Polyclonal Antibody (Biotin) [orb447021]
WB
Bovine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Biotin
100 μlADAMTS4 Rabbit Polyclonal Antibody (HRP) [orb480388]
WB
Bovine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
HRP
100 μlADAMTS4 Rabbit pAb, IRDye 800CW conjugated [orb2842006]
WB
Bovine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
IRDye800
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse Thrombospondin 2 protein (orb244587)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

