You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse SDF1 protein
Catalog Number: orb604017
| Catalog Number | orb604017 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Stromal cell-derived factor 1(Cxcl12),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Protein Length | Partial |
| UniProt ID | P40224 |
| MW | 12 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 22-89aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | 12-O-tetradecanoylphorbol 13-acetate repressed pro Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse SDF1 protein (Active) [orb359099]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Mouse SDF1 protein (Active) [orb359100]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg 
Mouse SDF-1 α/SDF1A ELISA Kit [orb409141]
Mouse
0.156 ng/mL-10 ng/mL
0.039 ng/mL
24 T, 48 T, 96 T, 10 x 96 T, 5 x 96 TMouse SDF1 ELISA Kit [orb409142]
Mouse
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 T
