You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 19-182aa |
| Protein Length | Full Length of Mature Protein |
| MW | 26.2 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cytokine tag7 (Peptidoglycan recognition protein short) (PGRP-S) (Pglyrp) (Pgrp) (Pgrps) (Tag7)
Similar Products
−- Item 1 of 1
Mouse Peptidoglycan Recognition Protein 1 (PGLYRP1) ELISA Kit [orb780309]
Mouse
15.63-1000 pg/mL
5.8 pg/mL
96 T, 48 T - Item 1 of 2
Mouse PGLYRP1 Protein, hFc Tag [orb1173670]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.8 kDa after removal of the signal peptide. The apparent molecular mass of mPGLYRP1-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
PGLYRP1 Mouse Monoclonal Antibody [orb2959078]
ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 1
PGLYRP1 Rabbit Polyclonal Antibody [orb2952245]
ELISA, IHC, WB
Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
Mouse PGLYRP1(Peptidoglycan Recognition Protein 1) Microsample ELISA Kit [orb2997870]
Mouse
15.63-1000 pg/mL
5.7 pg/mL
48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Mouse Pglyrp1 protein (orb604307)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks