You have no items in your shopping cart.
Mouse Noggin Protein
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4. |
| Protein Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse NOG/Noggin Protein, C-Fc [orb2965007]
>90% as determined by SDS-PAGE.
53 kDa
1 mg, 100 μg, 50 μgMouse Noggin protein [orb754972]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
22.4 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgMouse Noggin protein [orb707259]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 10 μg, 500 μgRecombinantNoggin,Mouse(CHO-expressed) [orb1494673]
> 95% as analyzed by SDS-PAGE.
29-31 kDa, observed by reducing SDS-PAGE.
CHO
5 μg, 25 μgRecombinant mouse Noggin protein (Active,CHO) [orb2328301]
≥ 95% as determined by SDS-PAGE.
29-31 kDa
500 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Request a Document
Protocol Information
Mouse Noggin Protein (orb427377)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review