Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 5-10 working days
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00Product Overview
Product Name | Mouse Noggin protein |
---|---|
Catalog Number | orb427377 |
Reactivity | Mouse |
Conjugation | Unconjugated |
Target | Noggin |
Alternative Names | (click to expand) |
Product Properties
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA. |
---|---|
Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Note | For research use only. |
Protein Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC. |
Purity | >95.0% as determined by SDS-PAGE. |
Source | Escherichia Coli. |
Activity | The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 |
Product Description
Mouse Noggin protein
Solubility (25°C)
Solubility (25°C) | It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions. |
---|
Reviews
Write Your Own Review