You have no items in your shopping cart.
Mouse Kitlg protein
SKU: orb594761
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of TF-1 cells is 4-12 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 18.4 kDa |
| Expression Region | 26-189aa |
| Protein Length | Partial |
| Protein Sequence | KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Kit ligand;Hematopoietic growth factor KL;Mast cell growth factor;MGF;Steel factor;Stem cell factor;SCF
Similar Products
−
Mouse SCF protein [orb754278]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
18 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgRat SCF protein [orb754291]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
17.9 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgHuman SCF protein [orb754292]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
39.1 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgRecombinant Mouse Kitl Protein, No Tag [orb1551712]
≥90% as determined by SDS-PAGE
This protein contains the mouse Kitlg(Lys26-Ala189) was fused without Tag and expressed in E. coli.
50 μg, 100 μgRecombinant Mouse SCF Protein, His Tag [orb1550778]
> 95% by SDS-PAGE.
Recombinant Mouse SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6��His Tag at the C-terminus.
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Kitlg protein (orb594761)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks