Mouse Kitlg protein

Catalog Number: orb594761

Catalog Number	orb594761
Category	Proteins
Description	Recombinant Mouse Kit ligand(Kitlg),partial (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	18.4 kDa
UniProt ID	P20826
Protein Sequence	KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 26-189aa. Protein Length: Partial
Biological Activity	The ED50 as determined by the dose-dependent stimulation of TF-1 cells is 4-12 ng/ml.
Expression Region	26-189aa
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alternative names	Kit ligand;Hematopoietic growth factor KL;Mast cel Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1711, Recombinant Mouse SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6×His Tag at the C-terminus.

Sizes Available: 100 μg, 50 μg

Conjugation:	Unconjugated
Purity:	95%
MW:	19.5 kDa
Source:	Mouse SCF, His Tag (orb257825) is expressed from human 293 cells (HEK293). It contains AA Lys 26 - Ala 189 (Accession # NP_038626).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Kitlg(Lys26-Ala189) was fused without Tag and expressed in E. coli.