You have no items in your shopping cart.
Mouse IL4 protein
SKU: orb594837
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.035 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 14.6 kDa |
| Expression Region | 21-140aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1
Similar Products
−
Human IL-4 RA [orb2994735]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 50.2 KDa. Observed: 65-86 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Mouse IL4 protein (Active) [orb359010]
> 97% as determined by SDS-PAGE and HPLC.
13.5 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Mouse IL4 protein [orb594835]
Greater than 95% as determined by SDS-PAGE.
13.4 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 2
- Item 1 of 2
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL4 protein (orb594837)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks