You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594837 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-4(Il4) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 14.6 kDa |
UniProt ID | P07750 |
Protein Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 21-140aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is less than 2 ng/ml. |
Expression Region | 21-140aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Interleukin-4; IL-4; IL4; B-cell IgG differentiati Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
13.5 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
13.4 kDa | |
E.coli |
Unconjugated | |
95% | |
51 kDa | |
Mouse IL-4 R alpha, Fc Tag (orb334907) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700). |
Unconjugated | |
95% | |
26.3 kDa | |
Mouse IL-4 R alpha, His Tag (orb334908) is expressed from human 293 cells (HEK293). It contains AA Ile 26 - Arg 233 (Accession # NP_001008700). |
Unconjugated | |
90% | |
15.0 kDa | |
Human IL-4, premium grade (orb257598) is expressed from human 293 cells (HEK293). It contains AA His 25 - Ser 153 (Accession # P05112-1). |
Filter by Rating