Mouse IL4 protein

• Catalog Number: orb594835
• Category: Proteins
• Description: Recombinant Mouse Interleukin-4(Il4),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Protein Length: Partial
• UniProt ID: P07750
• MW: 13.4 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml.
• Expression Region: 23-140aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Interleukin-4;B-cell IgG differentiation factor;B-
• Background: Mouse Interleukin-4(IL-4) is a monomeric, Th2 cyto
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.