You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594835 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-4(Il4),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Protein Length | Partial |
UniProt ID | P07750 |
MW | 13.4 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml. |
Expression Region | 23-140aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin-4;B-cell IgG differentiation factor;B- Read more... |
Background | Mouse Interleukin-4(IL-4) is a monomeric, Th2 cyto Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
13.5 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
14.6 kDa | |
Mammalian cell |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 41.2 kDa after removal of the signal peptide. The apparent molecular mass of IL4-mFc is approximately 35-55 kDa due to glycosylation. | |
E.coli |