Cart summary

You have no items in your shopping cart.

Mouse IL4 protein (Active)

Catalog Number: orb359010

Select Product Size
SizePriceQuantity
5 μg$ 210.00
100 μg$ 1,230.00
500 μg$ 2,650.00
5 μg Enquire
100 μg Enquire
500 μg Enquire
DispatchUsually dispatched within 1-2 weeks
Product Properties
Catalog Numberorb359010
CategoryProteins
DescriptionRecombinant mouse IL4 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered , PBS, pH 7.4
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Protein LengthFull Length of Mature Protein
UniProt IDP07750
MW13.5 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
SourceE.Coli
Biological OriginMus musculus (Mouse)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5 × 105 IU/mg.
Expression Region21-140aa
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative namesB cell growth factor 1 protein, B cell IgG differe
Read more...
Research AreaImmunology & Inflammation
NoteFor research use only
Expiration Date6 months from date of receipt.
Images
Mouse IL4 protein (Active)

Similar Products
  • Mouse IL4 protein [orb594835]

    Greater than 95% as determined by SDS-PAGE.

    13.4 kDa

    E.coli

    1 mg, 500 μg, 10 μg, 50 μg
  • Mouse IL4 protein [orb594837]

    Greater than 95% as determined by SDS-PAGE.

    14.6 kDa

    Mammalian cell

    1 mg, 500 μg, 50 μg, 10 μg
  • Recombinant Mouse Interleukin-4 protein(Il4) (Active) [orb1650627]

    5 μg, 20 μg, 100 μg, 1 mg, 250 μg, 500 μg
Reviews

Mouse IL4 protein (Active) (orb359010)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet