You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594830 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-13(Il13),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.7 kDa |
UniProt ID | P20109 |
Protein Sequence | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | 26-131aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 5 ng/ml. |
Expression Region | 26-131aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Interleukin-13; IL-13; T-Cell Activation Protein P Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
12.3 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
13.1 kDa | |
Mammalian cell |
Unconjugated | |
90% | |
15.0 kDa | |
Human IL-4, premium grade (orb257598) is expressed from human 293 cells (HEK293). It contains AA His 25 - Ser 153 (Accession # P05112-1). |
Unconjugated | |
95% | |
62.7 kDa | |
Mouse IL-13RA1, Fc Tag (orb257586) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Thr 340 (Accession # NP_598751). |
Greater than 95% as determined by SDS-PAGE. | |
11.7 kDa | |
E.coli |
Filter by Rating