You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594829 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-13(Il13) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| Protein Length | Partial |
| UniProt ID | P20109 |
| MW | 13.1 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 11.34 ng/ml. |
| Expression Region | 22-131aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-13; IL-13; T-Cell Activation Protein P Read more... |
| Background | Mouse interleukin 13 (mIL-13) is a pleiotropic cyt Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
12.3 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
12.7 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
11.7 kDa | |
E.coli |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review