Mouse IL13 protein

• Catalog Number: orb594829
• Category: Proteins
• Description: Recombinant Mouse Interleukin-13(Il13) (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Protein Length: Partial
• UniProt ID: P20109
• MW: 13.1 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 11.34 ng/ml.
• Expression Region: 22-131aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Interleukin-13; IL-13; T-Cell Activation Protein P
• Background: Mouse interleukin 13 (mIL-13) is a pleiotropic cyt
• Research Area: Immunology & Inflammation
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.