You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb359017 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse IL13 active protein |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | M+PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| Protein Length | Partial |
| UniProt ID | P20109 |
| MW | 12.3 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.Coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 4 ng/ml, corresponding to a specific activity of > 2.5 × 105 IU/mg. |
| Expression Region | M+22-131aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Allergic rhinitis protein, ALRH protein, BHR 1 pro Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

Greater than 95% as determined by SDS-PAGE. | |
13.1 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
12.7 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
11.7 kDa | |
E.coli |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review