You have no items in your shopping cart.
Featured
Active
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 1-208aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 24.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast growth factor 9;FGF-9;Glia-activating factor;GAF;heparin-binding growth factor-9;HBGF-9;Fgf9;Fgf-9
Similar Products
−
RecombinantFGF-9,Mouse [orb1494871]
> 95% as analyzed by SDS-PAGE and HPLC.
23.4 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgMouse FGF9 protein [orb707197]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgMouse FGF9 Protein, His Tag/His-IF2DI Tag [orb754755]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
22.6 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks