Mouse Fgf9 protein

• Catalog Number: orb594767
• Category: Proteins
• Description: Recombinant Mouse Fibroblast growth factor 9(Fgf9) (Active)
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 24.4 kDa
• UniProt ID: P54130
• Protein Sequence: MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Protein Length: Full Length
• Source: E.coli
• Expression System: Expression Region: 1-208aa. Protein Length: Full Length
• Biological Activity: The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml.
• Expression Region: 1-208aa
• Endotoxins: Less than 0.01 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
• Alternative names: Fibroblast growth factor 9;FGF-9;Glia-activating f
• Note: For research use only
• Application notes: Full Length
• Expiration Date: 6 months from date of receipt.