Mouse Fgf1 protein

Catalog Number: orb244205

Catalog Number	orb244205
Category	Proteins
Description	Recombinant mouse Fibroblast growth factor 1
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	19.8 kDa
UniProt ID	P61148
Protein Sequence	FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 16-155aa. Protein Length: Full Length of Mature Protein
Expression Region	16-155aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Fgf1 Fgf-1 Fgfa Read more...
Note	For research use only
Application notes	Full length of His-tag and expression region is 16-155aa
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1629, Recombinant Mouse FGF1/FGFa/FGF acidic Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).

Sizes Available: 50 μg, 500 μg

Recombinant Mouse FGF-1/Fgf1 Protein, His Tag [orb1552410]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the mouse Fgf1(Phe16-Asp155) was fused with the C-terminal His Tag and expressed in E. coli.
Sizes Available: 100 μg, 50 μg
Mouse FGF acidic protein [orb49774]
Source:
E.coli
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	15.7 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Fgf1(Phe16-Asp155) was fused with the C-terminal His Tag and expressed in E. coli.