You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Dock8 protein
Catalog Number: orb605034
| Catalog Number | orb605034 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Dedicator of cytokinesis protein 8(Dock8),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV |
| Protein Length | Partial |
| UniProt ID | Q8C147 |
| MW | 24.7 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 561-730aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Dock8Dedicator of cytokinesis protein 8 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse DOCK8 protein [orb419041]
Greater than 85% as determined by SDS-PAGE.
21.2 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse Dock8 protein [orb605033]
Greater than 85% as determined by SDS-PAGE.
55.8 kDa
E.coli
20 μg, 100 μg, 1 mg 
Recombinant Mouse Dedicator of cytokinesis protein 8(Dock8),partial [orb1646784]
100 μg, 20 μg, 1 mgRecombinant Mouse Dedicator of cytokinesis protein 8(Dock8),partial [orb1647121]
1 mg, 20 μg, 100 μg
