You have no items in your shopping cart.
Featured
Description
Research Area
Metabolism Research
Images & Validation
−
Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 2-87aa |
| Protein Length | Full Length of Mature Protein |
| MW | 16.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Diazepam-binding inhibitor (DBI) (Endozepine) (EP) (ACBP)
Similar Products
−- Item 1 of 4
ACBP rabbit pAb Antibody [orb764454]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
Mouse Diazepam Binding Inhibitor (DBI) ELISA Kit [orb781143]
Mouse
0.16-10 ng/mL
0.067 ng/mL
96 T, 48 T 
- Item 1 of 2
- Item 1 of 1
Mouse K33A Protein [orb1477081]
Greater than 90% as determined by SDS-PAGE.
17.4 kDa
E.coli
1 mg, 100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks