You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 80-301aa |
| Protein Length | Extracellular Domain |
| MW | 29.9 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Hepatic lectin 2 Short name, HL-2 Short name, mHL-2 Asgr-2
Similar Products
−- Item 1 of 1
Mouse ASGR2 protein [orb419119]
Greater than 90% as determined by SDS-PAGE.
45.9 kDa
E.coli
1 mg, 100 μg, 20 μg 
Recombinant Mouse ASGR2 Protein, N-His [orb2963766]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
17.70 kDa
1 mg, 50 μg, 100 μg
Recombinant Mouse ASGR2 Protein, N-His [orb2830524]
>90% as determined by SDS-PAGE.
17.7 kDa
20 μg, 50 μg, 100 μgMouse ASGR2 Protein, His Tag/His-IF2DI Tag [orb754344]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
24.3 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks