You have no items in your shopping cart.
Featured
Description
Research Area
Metabolism Research
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 19-311aa |
| Protein Length | Full Length of Mature Protein |
| MW | 37.9 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Apo-E
Similar Products
−- Item 1 of 1
Mouse Low Density Lipoprotein Receptor Related Protein 1 (LRP1) ELISA Kit [orb777659]
Mouse
1.57-100 ng/mL
0.63 ng/mL
48 T, 96 T 
Recombinant Mouse ApoE Protein [orb2994508]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 35 KDa. Observed: 30-40 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 3
APOE Mouse Monoclonal Antibody [orb2957282]
Blocking, ELISA
Human
Mouse
Monoclonal
Unconjugated
1 mg, 100 μg, 50 μg 
Mouse Low Density Lipoprotein Receptor Related Protein 8 (LRP8) ELISA Kit [orb2667052]
Mouse
31.25-2000 pg/mL
15.2 pg/mL
48 T, 96 T- Item 1 of 2
APOE Mouse Monoclonal Antibody [orb2960685]
Blocking, IHC
Mouse
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks