You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581940 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MLKL |
Target | MLKL |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MLKL |
Protein Sequence | Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE |
UniProt ID | Q8NB16 |
MW | 54 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | hMLKL |
Research Area | Epigenetics |
Note | For research use only |
NCBI | NP_689862 |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 54 kDa is present as well as a second isoform around ~30 kDa.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Sample Type: 293T Whole Cell lysates, Antibody dilution: 1 ug/ml.
Rabbit Anti-MLKL antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |