MGRN1 Rabbit Polyclonal Antibody

• Catalog Number: orb325059
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MGRN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGRN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: MGRN1
• UniProt ID: O60291
• Protein Sequence: Synthetic peptide located within the following region: EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS
• NCBI: NP_056061
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA0544 antibody, anti RNF156 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MGRN1 Antibody, Positive Control: Lane 1: 10 ug MGRN1-GFP transfected HEK293T Lane 2: 10 ug mut1MGRN1-GFP transfected HEK293T Lane 3: 10 ug mut1MGRN2-GFP transfected HEK293T Lane 4: 10 ug GFP transfected HEK293T Lane 5: 10 ug IP for GFP using lysate from lane 1, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:50000, MGRN1 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-MGRN1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, MGRN1 is supported by BioGPS gene expression data to be expressed in 721_B.