Cart summary

You have no items in your shopping cart.

MFAP4 Rabbit Polyclonal Antibody

SKU: orb578092

Description

Rabbit polyclonal antibody to MFAP4

Research Area

Cell Biology, Disease Biomarkers, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MFAP4
TargetMFAP4
Protein SequenceSynthetic peptide located within the following region: TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
Molecular Weight29kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • MFAP4 Antibody [orb628773]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • MFAP4 Rabbit Polyclonal Antibody [orb2950427]

    ELISA,  IHC,  WB

    Bovine, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • MFAP4 Rabbit Polyclonal Antibody [orb155111]

    ELISA,  IHC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MFAP4 Rabbit Polyclonal Antibody (HRP) [orb2123651]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • MFAP4 Rabbit Polyclonal Antibody (FITC) [orb2123652]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MFAP4 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is processed to ~26 kDa.

MFAP4 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

MFAP4 Rabbit Polyclonal Antibody

Positive control (+): Human Lung (LU), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.

MFAP4 Rabbit Polyclonal Antibody

Rabbit Anti-MFAP4 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Lung, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

MFAP4 Rabbit Polyclonal Antibody

Sample Type: Mouse sciatic nerve, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated Anti-Rabbit 1:1000 followed by avidin-biotin and diaminobenzidine, Secondary Antibody Dilution: 1:1000, Gene Name: MFAP4.

MFAP4 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

MFAP4 Rabbit Polyclonal Antibody

WB Suggested Anti-MFAP4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002395

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

MFAP4 Rabbit Polyclonal Antibody (orb578092)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry