Cart summary

You have no items in your shopping cart.

MEX3A Rabbit Polyclonal Antibody (FITC)

MEX3A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2087487

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087487
CategoryAntibodies
DescriptionMEX3A Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human MEX3A
Protein SequenceSynthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP
UniProt IDA1L020
MW54kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRKHD4, MEX-3A, RNF162
NoteFor research use only
NCBINP_001087194
  • MEX3A Rabbit Polyclonal Antibody (FITC) [orb189924]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl