MEX3A Rabbit Polyclonal Antibody

• Catalog Number: orb587187
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MEX3A
• Target: MEX3A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MEX3A
• Protein Sequence: Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP
• UniProt ID: A1L020
• MW: 54kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RKHD4, MEX-3A, RNF162
• Note: For research use only
• NCBI: NP_001087194

Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Brain (BR), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.