Melanostatin, frog

SKU: orb2693479

This product can be custom made

Description

Melanostatin, frog is an inhibitor for α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM.

Images & Validation

−

Key Properties

−

Target	Melanocortin Receptor
CAS Number	134709-16-3
MW	4243.76
Purity	≥95%
Formula	C₁₈₉H₂₈₅N₅₃O₅₇S
Protein Sequence	YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Melanocortin Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	> 95%
MW:	4243.76
Source:	Synthetic

Melanostatin, frog

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products