MED14 Rabbit Polyclonal Antibody

• Catalog Number: orb583889
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MED14
• Target: MED14
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED14
• Protein Sequence: Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
• UniProt ID: O60244
• MW: 161 kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CSRP, RGR1, CRSP2, EXLM1, CXorf4, CRSP150, DRIP150
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_004220

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. In addition to the 161 kDa canonical isoform, a 127 kDa putative isoform is present in some samples.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml, Positive Control: A549 cell lysate. MED14 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells.