MAS1 Rabbit Polyclonal Antibody

SKU: orb581299

Description

Rabbit polyclonal antibody to MAS1

Research Area

Cell Biology, Immunology & Inflammation, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAS1
• Target: MAS1
• Protein Sequence: Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII
• Molecular Weight: 37 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MAS, MGRA

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein may be modified by phosphorylation or glycosylation.

Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MAS1 antibody (orb581299).

WB Suggested Anti-MAS1 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

MAS1

UniProt

P04201

RefSeq (Protein):NP_002368