You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581299 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MAS1 |
Target | MAS1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAS1 |
Protein Sequence | Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII |
UniProt ID | P04201 |
MW | 37 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MAS, MGRA |
Note | For research use only |
NCBI | NP_002368 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein may be modified by phosphorylation or glycosylation.
Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MAS1 antibody (orb581299).
WB Suggested Anti-MAS1 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate.
IHC, WB | |
Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Rat | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |