MAS1 Rabbit Polyclonal Antibody

• Catalog Number: orb581298
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAS1
• Target: MAS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAS1
• Protein Sequence: Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
• UniProt ID: P04201
• MW: 37 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MAS, MGRA
• Note: For research use only
• NCBI: NP_002368

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human DLD1, Antibody dilution: 1.0 ug/ml.

Human kidney

WB Suggested Anti-MAS1 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.