Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mammal IFN Lambda protein

SKU: orb1215727

Description

The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)) (Gene ID: 112320026).

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

SourceYeast
Biological OriginBat
TargetIFN Lambda
Protein Length214.0
MW23.4 kDa
Purity98%
Protein SequencePPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Mammal IFN Lambda protein (orb1215727)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry