You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582700 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LSM14A |
| Target | LSM14A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A |
| Protein Sequence | Synthetic peptide located within the following region: KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI |
| UniProt ID | Q8ND56 |
| MW | 50kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | RAP55, FAM61A, RAP55A, C19orf13 |
| Research Area | Developmental Biology, Epigenetics |
| Note | For research use only |
| NCBI | NP_056393 |

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-LSM14A Antibody, Catalog Number: orb582700, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and plasma membrane in hepatocytes and sinusoids, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LSM14A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Feline, Gallus, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy5 |
ICC, IF | |
Bovine, Canine, Feline, Gallus, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Feline, Gallus, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review