LSM14A Rabbit Polyclonal Antibody

SKU: orb582699

This product can be custom made

Description

Rabbit polyclonal antibody to LSM14A

Research Area

Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human LSM14A
Target	LSM14A
Protein Sequence	Synthetic peptide located within the following region: TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP
Molecular Weight	50kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

RAP55, FAM61A, RAP55A, C19orf13

LSM14A/C19orf13 Rabbit Polyclonal Antibody [orb185080]

Applications:	ICC, IF, IHC-Fr, IHC-P
Predicted Reactivity:	Bovine, Canine, Feline, Gallus, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 50 μl, 100 μl, 200 μl

LSM14A/C19orf13 Rabbit Polyclonal Antibody (PE) [orb488967]
Applications:
ICC, IF
Predicted Reactivity:
Bovine, Canine, Feline, Gallus, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Species/Host:
Rabbit
Clonality:
Polyclonal
Conjugation:
PE
Sizes Available: 100 μl

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-LSM14A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. LSM14A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Quick Database Links

Gene Symbol

LSM14A

UniProt

Q8ND56

RefSeq (Protein):NP_056393

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_056393

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols