Cart summary

You have no items in your shopping cart.

LRPAP1 Rabbit Polyclonal Antibody (Biotin)

LRPAP1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2118235

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2118235
CategoryAntibodies
DescriptionLRPAP1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human LRPAP1
Protein SequenceSynthetic peptide located within the following region: IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
UniProt IDP30533
MW39kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRAP, MRAP, A2RAP, HBP44, MYP23, A2MRAP, alpha-2-MR
Read more...
NoteFor research use only
NCBINP_002328
Images
Similar Products
Reviews

LRPAP1 Rabbit Polyclonal Antibody (Biotin) (orb2118235)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet