LRPAP1 Rabbit Polyclonal Antibody

• Catalog Number: orb579427
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LRPAP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LRPAP1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: LRPAP1
• UniProt ID: P30533
• Protein Sequence: Synthetic peptide located within the following region: IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
• NCBI: NP_002328
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RAP, MRAP, A2RAP, HBP44, MYP23, A2MRAP, alpha-2-MR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-LRPAP1 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.