LMX1A Rabbit Polyclonal Antibody

• Catalog Number: orb574007
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LMX1A
• Target: LMX1A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LMX1A
• Protein Sequence: Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL
• UniProt ID: Q8TE12
• MW: 43kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LMX1, DFNA7, LMX1.1
• Note: For research use only
• NCBI: NP_796372
• Expiration Date: 12 months from date of receipt.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-LMX1A Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-LMX1A Antibody Titration: 0.3125 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.