LMX1A Rabbit Polyclonal Antibody

• Catalog Number: orb576464
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LMX1A
• Target: LMX1A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD
• UniProt ID: Q9JKU8
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: dr, sst, Lmx1., Lmx1.1, dreher
• Research Area: Epigenetics & Chromatin, Signal Transduction, Stem
• Note: For research use only
• NCBI: NP_387501

WB Suggested Anti-LMX1A Antibody Titration: 5.0 ug/ml, Positive Control: SP2/0 cell lysate.